PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 370aa    MW: 41689.2 Da    PI: 5.9077
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04147.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS343.43.9e-105236915374
       GRAS  15 gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHi 114
                ++ +++q+lL+ l+el+sp+gd+ q+laayf++AL +r+++s++++y++l + ++++ + +++ +++  f+evsP+ +f+h++ N aI+ea+ege ++Hi
  PK04147.1   2 KNSSRVQQLLWMLNELSSPYGDADQKLAAYFLQALFSRVNDSGNRCYRTLLSASDKTCSFESTRKMVLKFQEVSPWTTFGHVASNGAIMEAFEGEPKLHI 101
                68899********************************************97777765554444455556******************************* PP

       GRAS 115 iDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvlvak.rledleleeLrvkpgEalaVnlv 207
                iD++ + ++QWp+Ll+aLa+R++++p+lR+T+v+s+++        ++ ++e+g r++kfA+ +gvpf+fnv+++  +l++l+l eL+v+ +EalaVn+v
  PK04147.1 102 IDIGNTFCTQWPTLLEALATRTDDTPHLRLTTVVSARNCgtdggsVQKVMKEIGTRMEKFARLMGVPFKFNVVHHYgDLSELNLAELDVRDDEALAVNCV 201
                ***********************************88879999999999***********************97667*********************** PP

       GRAS 208 lqlhrlldesvsleserdevLklvkslsPkvvvvveqe....adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacega 303
                  lh++     ++e++rd +  +++sl+P+vv+vve+e    + h++ +F+++f e+++++ + f++l++++pr+s+er ++Er+  gr++v+++ac+ +
  PK04147.1 202 NTLHSVA----AVENRRDYLAAAFRSLRPRVVTVVEEEaeldVGHDGIEFVRGFQECVRWFRVYFEALDESFPRTSNERLMLERA-AGRAVVDLIACSPS 296
                ******8....89999999******************93333345556*************************************.************** PP

       GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve..eesgslv.lgWkdrpLvsvSaWr 374
                +++er+et+ +W++rl+ aGF+p+++s+++ +++++llr++k +g+ +   ++ g+ + l+Wkd+p+v++SaW+
  PK04147.1 297 DSVERRETAVRWSRRLHGAGFSPAAFSDEVLDDVRALLRRYK-EGWAMTqcSDAGAGIfLTWKDQPVVWTSAWK 369
                ******************************************.5544442355555555**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.5211347IPR005202Transcription factor GRAS
PfamPF035141.3E-1022369IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
DKNSSRVQQL LWMLNELSSP YGDADQKLAA YFLQALFSRV NDSGNRCYRT LLSASDKTCS  60
FESTRKMVLK FQEVSPWTTF GHVASNGAIM EAFEGEPKLH IIDIGNTFCT QWPTLLEALA  120
TRTDDTPHLR LTTVVSARNC GTDGGSVQKV MKEIGTRMEK FARLMGVPFK FNVVHHYGDL  180
SELNLAELDV RDDEALAVNC VNTLHSVAAV ENRRDYLAAA FRSLRPRVVT VVEEEAELDV  240
GHDGIEFVRG FQECVRWFRV YFEALDESFP RTSNERLMLE RAAGRAVVDL IACSPSDSVE  300
RRETAVRWSR RLHGAGFSPA AFSDEVLDDV RALLRRYKEG WAMTQCSDAG AGIFLTWKDQ  360
PVVWTSAWKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-322236937375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205058.10.0hypothetical protein PRUPE_ppa004454mg
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLM5VXS80.0M5VXS8_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein